DPCfam | MC13955
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 411 ± 48 aa |
| Residues in low-complexity regions (%) | 13.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 63.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12202 |
| Sequences matching dominant architecture (%) | 1.79 |
| Average overlap percent | 12.7 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D5PHA9 | 479-904 | 426 | TPAKTIGRFSVSSTQDELTLAAPHCLRFSAPPDVYLDELPSSPDQKTAVRRVQTASSVDVLCDQGSSDSAEEPFHRQAAAAQPSP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Y3S1-F1 | 1772-2198 | 99.34 | 36.85 | View in AlphaFoldDB ↗ |