DPCfam | MC139467
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Residues in low-complexity regions (%) | 8.69 |
| Residues in coiled-coil regions (%) | 2.82 |
| Predicted disordered residues (%) | 15.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13414 |
| Sequences matching dominant architecture (%) | 2.33 |
| Average overlap percent | 3.33 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4SB45 | 5-90 | 86 | CPACRKINPTNRKCPRCGCDLSSLWNLLECAERELRRGAEQLKNNNGLPALEHAKRAWGINKSARAAKLAFLACILAMRFDEATV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IFJ1-F1 | 45-92 | 60.00 | 92.51 | View in AlphaFoldDB ↗ |