DPCfam | MC139340
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Residues in low-complexity regions (%) | 1.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8Y8V1 | 480-560 | 81 | RRLQFNKHGVLRVEGFLTPNKYDSEAIGLWLPLTRNVVGTDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6ZPY7-F1 | 744-824 | 100.00 | 89.00 | View in AlphaFoldDB ↗ |