DPCfam | MC13926
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1111 |
|---|---|
| Mean domain length (aa) | 66 ± 11 aa |
| Residues in low-complexity regions (%) | 1.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00149 |
| Sequences matching dominant architecture (%) | 71.69 |
| Average overlap percent | 26.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167LV94 | 174-233 | 59 | SLPPGVDILLTHSPPLGPTPLDQTSRGVHAGCKVLARKVRELEVGPWLHVFGHIHEGWG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q21268-F1 | 205-268 | 97.01 | 97.79 | View in AlphaFoldDB ↗ |