DPCfam | MC139254
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Residues in low-complexity regions (%) | 2.42 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 28.95 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF16858 |
| Sequences matching dominant architecture (%) | 98.6 |
| Average overlap percent | 57.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E0VD64 | 418-541 | 124 | EYQKLVNEELKEHYAAKSSFAQNKELGVKIAKWFEMIADKINLSQRRGALNMKSLASKIMKSFPCQPSERPLMKFQDLVENQSRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q28GV1-F1 | 496-606 | 98.26 | 87.54 | View in AlphaFoldDB ↗ |