DPCfam | MC139088
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 534 ± 133 aa |
| Residues in low-complexity regions (%) | 4.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.43 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00249 |
| Sequences matching dominant architecture (%) | 9.23 |
| Average overlap percent | 15.92 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W1PLA4 | 78-590 | 513 | DCLKATGWGSINIDGSLAIVSQGVGGLLGEHERSRLGSCNKSFSDNCRNKLLRLDDSVGLETKCPALVSLDSSSERLSCGRALHR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7M3F1-F1 | 24-701 | 99.84 | 52.86 | View in AlphaFoldDB ↗ |