DPCfam | MC139030
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 70 ± 15 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01450 |
| Sequences matching dominant architecture (%) | 82.46 |
| Average overlap percent | 48.79 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8N620 | 300-392 | 93 | QTTFKEETETDLFGEQAVLCGGVSALITAGFEVLVEAGYSAEMAYFECLHELKLIVDLIYEGGLGDMRYSISNTAEYGDYSLEYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B4U6I9-F1 | 170-260 | 98.91 | 97.92 | View in AlphaFoldDB ↗ |