DPCfam | MC139009
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 145 ± 10 aa |
| Residues in low-complexity regions (%) | 1.11 |
| Residues in coiled-coil regions (%) | 15.57 |
| Predicted disordered residues (%) | 24.25 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077DB1B1 | 1821-1983 | 163 | GTRKTKMVGSPVTAQQHEDRYFVDVEAQRKNLAILNHAAQTAGLPSQYHTIARNLIIELLHMNTVRLGYLSRKYLAYRLIQLARN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6NE01-F1 | 2105-2247 | 99.31 | 84.94 | View in AlphaFoldDB ↗ |