DPCfam | MC138847
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Residues in low-complexity regions (%) | 1.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06755 |
| Sequences matching dominant architecture (%) | 93.1 |
| Average overlap percent | 86.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D2ZFS8 | 15-78 | 64 | SLSPVAVWQILLTRLLEQHYCLILNDTPFSDETIIKEHIDAGIPLADAVNFLVDKYELVRIERR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q46953-F1 | 18-94 | 100.00 | 91.84 | View in AlphaFoldDB ↗ |