DPCfam | MC138627
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 347 ± 64 aa |
| Residues in low-complexity regions (%) | 11.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 51.13 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08880- PF08879 |
| Sequences matching dominant architecture (%) | 93.15 |
| Average overlap percent | 31.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1FER1 | 4-353 | 350 | LSGTSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELILSIRRSLDSSLVSRLLPHQSIGWGCYQMGSGRKPDPEPGRCR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1M8W0-F1 | 145-538 | 99.12 | 52.03 | View in AlphaFoldDB ↗ |