DPCfam | MC137993
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1811 |
|---|---|
| Mean domain length (aa) | 167 ± 23 aa |
| Residues in low-complexity regions (%) | 2.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09250 |
| Sequences matching dominant architecture (%) | 95.1 |
| Average overlap percent | 90.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1T2L599 | 10-116 | 106 | ALRYAERGWPVLPLNGKRPAIKGGVHSASTEQDFIRKSFANGSNIGIQTGKTSGIVAIDIDPRNGGDETLSKLLGQYGELPQTLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F5S8-F1 | 24-173 | 93.33 | 95.58 | View in AlphaFoldDB ↗ |