DPCfam | MC137941
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 1360 ± 130 aa |
| Residues in low-complexity regions (%) | 3.82 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 19.65 |
| Average transmembrane regions | 0.23 |
| Dominant Pfam architecture(s) | PF12920 |
| Sequences matching dominant architecture (%) | 83.33 |
| Average overlap percent | 48.09 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8Q533 | 828-2147 | 1320 | VPQDLLLSSDGETIGGRCYPLALVMSAALAQGDVASGHLRERFFLAVLEPGQADSQAFVQILEALRDVSLGEVGTRLGQASLDQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9EXR0-F1 | 841-1450 | 43.26 | 74.21 | View in AlphaFoldDB ↗ |