DPCfam | MC137860
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 1468 ± 277 aa |
| Residues in low-complexity regions (%) | 2.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.72 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05879 |
| Sequences matching dominant architecture (%) | 33.33 |
| Average overlap percent | 5.16 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K6G706 | 99-1430 | 1332 | DDITTRIPLMYRLIDIVYENGSVGQGGLVEKFIVDQDSLGKLLNKLAPGSFRSISNIDFKSLDEITVKPKGVYGIRSEIVKFLLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FKE9-F1 | 42-129 | 5.00 | 88.06 | View in AlphaFoldDB ↗ |