DPCfam | MC137786
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Residues in low-complexity regions (%) | 0.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13673 |
| Sequences matching dominant architecture (%) | 45.07 |
| Average overlap percent | 24.32 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M6F0A1 | 2-60 | 59 | STRIERVAALPPGFPTLRDAALAEGWRMLRVLEEDWTSGVLRFDGPGEGMFAAWRGNSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H0E6-F1 | 11-66 | 91.80 | 97.44 | View in AlphaFoldDB ↗ |