DPCfam | MC137179
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Residues in low-complexity regions (%) | 17.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05236 |
| Sequences matching dominant architecture (%) | 94.94 |
| Average overlap percent | 31.81 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2ZZ90 | 990-1071 | 81 | LTALAAIGPRKKRKLDLPGPTAAGGEGSGVSNGAQAGPGAATSRQYSRQRITRVNLRDFIFCLEQEQNTSHSLMLYRALLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FFQ2-F1 | 895-976 | 100.00 | 65.59 | View in AlphaFoldDB ↗ |