DPCfam | MC136843
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 135 ± 14 aa |
| Residues in low-complexity regions (%) | 9.95 |
| Residues in coiled-coil regions (%) | 0.32 |
| Predicted disordered residues (%) | 0.59 |
| Average transmembrane regions | 3.22 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3TGV8 | 8-143 | 136 | VFYIIAVAFLTIKTILVYFCEFDLRGKSMMEMLLLFLNPIGSVALFLGISFFFSKKIRIVCMLIVYTVLTGILFGNILYYRFYID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132P967-F1 | 15-158 | 99.30 | 93.34 | View in AlphaFoldDB ↗ |