DPCfam | MC136637
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Residues in low-complexity regions (%) | 5.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N0UL52 | 9-77 | 69 | VAILAMATTSLAGCFESEKVVEPVQSVEWFKSNDNVRKETLEKCANNPGELKETPNCKNALEAETQLSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PAS6-F1 | 4-57 | 88.06 | 87.00 | View in AlphaFoldDB ↗ |