DPCfam | MC136519
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Residues in low-complexity regions (%) | 0.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.87 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF07651 |
| Sequences matching dominant architecture (%) | 97.76 |
| Average overlap percent | 15.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M0RFD2 | 6-67 | 62 | IRKALGAVKDQTSIGLAKVSSSATLSDLDVAIVKATRHNELPAKEKHILEILSLMCYSRAYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LVM2-F1 | 6-79 | 98.65 | 87.86 | View in AlphaFoldDB ↗ |