DPCfam | MC135709
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Residues in low-complexity regions (%) | 3.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15636 |
| Sequences matching dominant architecture (%) | 86.36 |
| Average overlap percent | 5.06 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006B103BD | 2585-2716 | 132 | FSMESVPFGKGIILSRVHGKAIVRSVKEADSIRRNVFTSVFNGSYLLDLHLFMHSMDVFYFVKDSTWRVSEDLNQLQRLGTSINT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W7R4-F1 | 2484-2621 | 100.00 | 87.49 | View in AlphaFoldDB ↗ |