DPCfam | MC135514
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 497 ± 79 aa |
| Residues in low-complexity regions (%) | 4.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.04 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF12859 |
| Sequences matching dominant architecture (%) | 51.9 |
| Average overlap percent | 12.02 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P4WJL7 | 1-562 | 562 | MISCGDAQDFVPFGRDYLEHHPGEVGLPPPRPSQVPPHIDLLRQLDTVSINGSKEWWDVRHSKDGLTEEELYVSGSRVVWSRGQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9H1A4-F1 | 11-565 | 99.62 | 65.55 | View in AlphaFoldDB ↗ |