DPCfam | MC135393
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 3.09 |
| Predicted disordered residues (%) | 12.11 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF03066 |
| Sequences matching dominant architecture (%) | 0.92 |
| Average overlap percent | 0.48 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9VDC9 | 599-739 | 141 | NDNNTIEGEGITVDDLVLLCDLFYLPFEHGSRGHKLLVEFNWLKGNANVILQDRSAGGGGDAIKSDKPEVSEWHQRREQFDQLCS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9EQQ9-F1 | 553-689 | 100.00 | 86.16 | View in AlphaFoldDB ↗ |