DPCfam | MC135285
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 252 ± 42 aa |
| Residues in low-complexity regions (%) | 13.24 |
| Residues in coiled-coil regions (%) | 2.34 |
| Predicted disordered residues (%) | 28.83 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF12234 |
| Sequences matching dominant architecture (%) | 2.22 |
| Average overlap percent | 11.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8TDJ6-2 | 1295-1618 | 324 | MDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q409-F1 | 752-1049 | 99.63 | 52.88 | View in AlphaFoldDB ↗ |