DPCfam | MC135236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 641 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Residues in low-complexity regions (%) | 2.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.14 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04492 |
| Sequences matching dominant architecture (%) | 2.43 |
| Average overlap percent | 82.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R6A2R6 | 4-113 | 110 | GYVSVPREFFDSIQWRRKRIFTESEAYLDLLQMAYYGSEPTERMVGGAKVEICHGQLAAQQNYLTQRWGWTRYKVRRFFTFLCAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GNW6-F1 | 10-125 | 94.26 | 84.08 | View in AlphaFoldDB ↗ |