DPCfam | MC135180
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Residues in low-complexity regions (%) | 2.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.7 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06516 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 34.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165H0H2 | 31-124 | 94 | SEPISPKVMIITGFTPEREIWYPYNLTNDYPMPGFIPTYQNVSCTASDEICVMTMGQAEIGNGIAMTLLWSSPMFNLTETYFLIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GFK9-F1 | 38-131 | 98.91 | 98.08 | View in AlphaFoldDB ↗ |