DPCfam | MC135166
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00168 |
| Sequences matching dominant architecture (%) | 89.29 |
| Average overlap percent | 31.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2V9N2 | 1525-1613 | 88 | GPECYELQVCVKDYCFAREDRTVGMAVLQLKDVASKGSVACWLPLGKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Z1N9-F1 | 1510-1597 | 98.88 | 85.04 | View in AlphaFoldDB ↗ |