DPCfam | MC134903
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00076 |
| Sequences matching dominant architecture (%) | 1.72 |
| Average overlap percent | 43.42 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D2P230 | 325-455 | 131 | VSDSSLITCGGGMDIRHVVTGFELCRITIKNLPYDARHDEVVDIFTHQGIDASEFFIQEVKPIGNKVEAIVLANAEQGEAIALGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LY67-F1 | 507-590 | 61.81 | 84.45 | View in AlphaFoldDB ↗ |