DPCfam | MC134835
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Residues in low-complexity regions (%) | 1.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.89 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0I9NAV1 | 369-497 | 129 | KILDLTTNGASPVHFDDSSWESYKGSLLPFGISSVVNGCSLLPDYTLFLNHISSISEAVSNTIAISNRHCLCPLTQLLGIGDEVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VQZ1-F1 | 469-622 | 98.52 | 73.68 | View in AlphaFoldDB ↗ |