DPCfam | MC13473
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 176 ± 20 aa |
| Residues in low-complexity regions (%) | 3.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000718903E | 163-346 | 184 | VEMLGQALGGLRPWTFAMQPQGTGPFLNVAGNLAGVPLALRVQNQLNPADPDNHTQVLHRITLGTSGGTLSLTDTHGSVLWSPRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GVL9-F1 | 169-346 | 98.90 | 97.65 | View in AlphaFoldDB ↗ |