DPCfam | MC134695
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 117 ± 8 aa |
| Residues in low-complexity regions (%) | 4.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08174 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 66.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6LE50 | 148-271 | 124 | VLSTDVVCAPRSLHTHNRLTFPNTLVLDGLYSDFKVRLEVYTMTARSKEIIPHDVKYHINTSKKDASKLKLTPRKGKGDSRLMMP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9V4P1-F1 | 969-1085 | 100.00 | 79.39 | View in AlphaFoldDB ↗ |