DPCfam | MC134514
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1671 |
|---|---|
| Mean domain length (aa) | 220 ± 51 aa |
| Residues in low-complexity regions (%) | 2.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.51 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF02666 |
| Sequences matching dominant architecture (%) | 94.46 |
| Average overlap percent | 86.55 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E1X2X3 | 1-206 | 205 | MGLTYLPKWIYSCITFVALLLMLIIGVWGFLFAALVYGILFAIFRKQKEDFRKDSNENVIVSPVNGRVYKIEKNVDHEFFGKDMT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5R8I8-F1 | 134-399 | 98.45 | 86.01 | View in AlphaFoldDB ↗ |