DPCfam | MC134435
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Residues in low-complexity regions (%) | 5.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.65 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF06495 |
| Sequences matching dominant architecture (%) | 0.75 |
| Average overlap percent | 4.49 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A074ZKQ0 | 682-770 | 89 | LEPKCPVWELPAGLMHPLIPLCDFDYTPLDGSKMRLLPPKAPTERLLVAIDAFYLPPSHDRTRDGEGWERLGLYEFYTKKENARD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7ZVL5-F1 | 622-714 | 96.12 | 83.90 | View in AlphaFoldDB ↗ |