DPCfam | MC133850
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Residues in low-complexity regions (%) | 5.35 |
| Residues in coiled-coil regions (%) | 13.47 |
| Predicted disordered residues (%) | 35.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0I9YIB5 | 33-114 | 82 | LEVLVQDLNKNTTTLNGYLRANKLPEPSFERDAPIINLSPDAPEEAQVAKEKVLDSALQIFQLVSGPGEYLQNVITGYHYME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2V5HP22-F1 | 3-75 | 96.00 | 94.57 | View in AlphaFoldDB ↗ |