DPCfam | MC133843
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2661 |
|---|---|
| Mean domain length (aa) | 259 ± 28 aa |
| Residues in low-complexity regions (%) | 3.71 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 24.86 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02424 |
| Sequences matching dominant architecture (%) | 95.56 |
| Average overlap percent | 94.52 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5J258 | 40-308 | 269 | VYSDNQEIAAVAITDAAAQMRQVEAMFTTYGETKNTVKTFNAAQVFTPVQLDAPVDALLQQSLSLMQNYQGSFDPALGQLSLAWG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5F5Y3-F1 | 50-303 | 98.56 | 94.21 | View in AlphaFoldDB ↗ |