DPCfam | MC133744
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.98 |
| Average transmembrane regions | 0.3 |
| Dominant Pfam architecture(s) | PF06835 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B3PKQ7 | 5-94 | 90 | GWDQISLYMPVLLMGLLALGTWWLVRNAPVPASTAVERGPGHQPDYFMKSFSLKSFDAKGRLQSEVLGDVARHYPDTDTLEIDKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F6F2-F1 | 10-88 | 95.24 | 91.71 | View in AlphaFoldDB ↗ |