DPCfam | MC133692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 311 ± 41 aa |
| Residues in low-complexity regions (%) | 0.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01764 |
| Sequences matching dominant architecture (%) | 78.95 |
| Average overlap percent | 7.5 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4JYS5 | 10-301 | 292 | MTTATPSKGIHVNMPDRQKKYWVEFLLLDEQGKPVADMPYLLKAGDGDRKGKTDAQGLLREDNMPWFPVYLLVAAQALADEMEKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KS43-F1 | 8-275 | 90.85 | 89.69 | View in AlphaFoldDB ↗ |