DPCfam | MC13362
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Residues in low-complexity regions (%) | 4.49 |
| Residues in coiled-coil regions (%) | 0.45 |
| Predicted disordered residues (%) | 19.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12095 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 92.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q10YP4 | 5-85 | 81 | LMYEEENYVVLEANKPEQFMTAVELLEKLRGIIATQQDNLPRDLQKLSSLDDQAEKLRDTYCEYEFTPGKFIQWYVVRLEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JMG0-F1 | 71-151 | 96.34 | 86.09 | View in AlphaFoldDB ↗ |