DPCfam | MC133472
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01261 |
| Sequences matching dominant architecture (%) | 92.54 |
| Average overlap percent | 24.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G3MPL1 | 203-319 | 117 | NPAEDLCILHESGLPYYIHINDNDAKWDWDYFAGSHHILRYTEFLYYLRKFKYNDYVTSDTSPTRWDIKRTFEINNRLTTKLLKV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6D5T7-F1 | 210-324 | 100.00 | 97.94 | View in AlphaFoldDB ↗ |