DPCfam | MC133259
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 561 ± 61 aa |
| Residues in low-complexity regions (%) | 5.46 |
| Residues in coiled-coil regions (%) | 2.66 |
| Predicted disordered residues (%) | 19.2 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF00619 |
| Sequences matching dominant architecture (%) | 5.71 |
| Average overlap percent | 14.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00064EF191 | 395-893 | 499 | DFIALMKLLKGLIQDGYESLLDQRCRCVFKAFTHLINGLDNKKIKELTEAEKQFKRILRLYPNEGLDCLAYCGIGSVYLKKNRFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P53804-F1 | 483-1009 | 99.44 | 79.91 | View in AlphaFoldDB ↗ |