DPCfam | MC133232
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1541 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Residues in low-complexity regions (%) | 10.39 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 2.82 |
| Average transmembrane regions | 1.9 |
| Dominant Pfam architecture(s) | PF09527 |
| Sequences matching dominant architecture (%) | 92.84 |
| Average overlap percent | 77.77 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L0REZ3 | 25-90 | 66 | KRRIRAGKKGTVGAWTAFGSMGVVGWFVALPTFLGSLFGAWLDYNWPSKISWTLTMLGAGLFTGCV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P15011-F1 | 42-98 | 86.36 | 93.33 | View in AlphaFoldDB ↗ |