DPCfam | MC132825
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12604 |
| Sequences matching dominant architecture (%) | 1.04 |
| Average overlap percent | 12.0 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V0VRD0 | 496-573 | 78 | LTGGLTSSGEIVSKYANGFRIAYGSFGFFIRNDGSNTYFMLTASGDTLGSWNGLRPITINNTSGAVSIGNGLNVTGGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P76072-F1 | 709-777 | 90.79 | 89.63 | View in AlphaFoldDB ↗ |