DPCfam | MC132739
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 567 ± 111 aa |
| Residues in low-complexity regions (%) | 10.29 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 48.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000455F7CA | 113-766 | 654 | GARNITQTQAYLSIFADHLASTKAHLSGSSQAHEQPPFNDFDEISDVAWTSSTHPWSRTELDAFFHALSIHSRWRPDLVAEDVSH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O14013-F1 | 71-172 | 17.54 | 88.07 | View in AlphaFoldDB ↗ |