DPCfam | MC132537
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 340 ± 45 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.74 |
| Average transmembrane regions | 0.26 |
| Dominant Pfam architecture(s) | PF06870 |
| Sequences matching dominant architecture (%) | 93.52 |
| Average overlap percent | 93.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E9NJN0 | 43-415 | 373 | PQNLTFDAYKRKKPKKSSEAKDVVLHGSTDRIEFDAQNFGHGEEGLCDYYVGIYDKSTNKVEIVPAPHVHVTRTVKALKNISRDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NQW9-F1 | 89-502 | 99.71 | 76.44 | View in AlphaFoldDB ↗ |