DPCfam | MC132504
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Residues in low-complexity regions (%) | 2.34 |
| Residues in coiled-coil regions (%) | 4.44 |
| Predicted disordered residues (%) | 15.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I1BMS7 | 54-180 | 127 | SITTFEEIQKQLKSTLDHIEQKNMVSGFQTLSKATAAVVEHCEQLGLTSDDHPYNAIDREQFWAGLNNCWLYALAQRHEPSNDSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W5P9-F1 | 144-275 | 99.27 | 94.78 | View in AlphaFoldDB ↗ |