DPCfam | MC132384
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Residues in low-complexity regions (%) | 4.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.24 |
| Average transmembrane regions | 1.76 |
| Dominant Pfam architecture(s) | PF04346 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L0FT34 | 3-106 | 104 | NIGTYVIYVIMVCAVIGAIASIVNAESELAKEFTAGLHSIGPIFIPVAGIMAAIPFISSFISLVIGPLFLAMGADAGIAGPIFIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GFN0-F1 | 3-94 | 100.00 | 94.13 | View in AlphaFoldDB ↗ |