DPCfam | MC132372
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 308 ± 49 aa |
| Residues in low-complexity regions (%) | 5.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.68 |
| Average transmembrane regions | 0.12 |
| Dominant Pfam architecture(s) | PF13840- PF13840 |
| Sequences matching dominant architecture (%) | 40.18 |
| Average overlap percent | 84.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C9MGX3 | 1176-1482 | 307 | IVKILLFTDTNVSDYFFSFTENAYGISIVADEKAIEQDFLPALEAASCPALDVANGVFRVLQVDEEYGQELGGKRISEISEPLAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CW82-F1 | 76-446 | 99.68 | 78.27 | View in AlphaFoldDB ↗ |