DPCfam | MC132361
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Residues in low-complexity regions (%) | 0.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00593 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 24.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H8FGA7 | 297-380 | 83 | LFGSGLRTDTDTVPNGASLPSYFQLNASVGHDFDVNTHPLHVQLAAVNVLNRSYQLRDGGGIGVFAPQWAPRRGVYVSLQQDF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GTE5-F1 | 661-705 | 54.12 | 96.80 | View in AlphaFoldDB ↗ |