DPCfam | MC132196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 61 ± 9 aa |
| Residues in low-complexity regions (%) | 4.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.27 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF05175 |
| Sequences matching dominant architecture (%) | 62.9 |
| Average overlap percent | 25.91 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000441E1AA | 2-67 | 66 | IPTPRHQHVGPEGPFSAVYEPAEDTYLLLDALEQDAEALRSARIDICLEVGSGSGVVSTFLASVVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VQF8-F1 | 3-63 | 95.31 | 96.60 | View in AlphaFoldDB ↗ |