DPCfam | MC131817
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09739 |
| Sequences matching dominant architecture (%) | 98.37 |
| Average overlap percent | 44.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183RER2 | 5-103 | 99 | LQNHSSKVPLFGIASLEQIPDGHLVRVVGMVQDMFNAELFMDSFRLSLNDSTTRSLRYRDFSCFENSDDASPIDVKFSERQSFYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZJV4-F1 | 29-143 | 96.61 | 89.39 | View in AlphaFoldDB ↗ |