DPCfam | MC131773
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Residues in low-complexity regions (%) | 1.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.59 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF13641 |
| Sequences matching dominant architecture (%) | 63.27 |
| Average overlap percent | 11.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q6E074 | 350-478 | 129 | MATIKREGLPLPLFVRSDDAEYALRCKAKIMAMNGICVWHNAFFYKYSSAVERYQVSRNTLISQATTGIAPMTDFLMEIYREVQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EKX8-F1 | 400-509 | 89.17 | 95.46 | View in AlphaFoldDB ↗ |