DPCfam | MC13163
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Residues in low-complexity regions (%) | 6.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02186- PF18121 |
| Sequences matching dominant architecture (%) | 59.91 |
| Average overlap percent | 58.96 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A179IB40 | 14-216 | 203 | PKSMKDLIDHLSVRNTSEEHKQELAEGLRGHPRVEWKPDTSLSEQTWKTGTYSYRPVVPGVTDGTSLLAFLQRKTDASSLAVRDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2KJF9-F1 | 72-280 | 100.00 | 71.01 | View in AlphaFoldDB ↗ |